OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPNE1 (NM_152927) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323828
Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA345867 Rabbit Polyclonal Anti-CPNE1 Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CPNE1 or NM_152927"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223828 representing NM_152927
Red=Cloning site Green=Tags(s)

MAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELGRTERVRNCSSPEFSKTLQLEYRFET
VQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGKPAGRGTITVSAQELKDNRVV
TMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
QCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMG
GCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ
VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLL
TDGAVTDVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQ
NAPREALAQTVLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_690904
Locus ID 8904
UniProt ID Q99829
Cytogenetics 20q11.22
RefSeq Size 2107
RefSeq ORF 1611
Synonyms COPN1; CPN1
Summary Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. provided by RefSeq, Aug 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CPNE1" proteins (16)
SKU Description Size Price
PH312736 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690905) 10 ug
$3,360.00
PH312892 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690902) 10 ug
$3,360.00
PH321043 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690906) 10 ug
$3,360.00
PH321253 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690903) 10 ug
$3,360.00
PH323828 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690904) 10 ug
$3,360.00
LC407221 Lyophilized CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407223 Lyophilized CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407224 Lyophilized CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407221 Transient overexpression lysate of copine I (CPNE1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY407223 Transient overexpression lysate of copine I (CPNE1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY407224 Transient overexpression lysate of copine I (CPNE1), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP312736 Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 5, 20 µg 20 ug
$737.00
TP312892 Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 1, 20 µg 20 ug
$737.00
TP321043 Recombinant protein of human copine I (CPNE1), transcript variant 6, 20 µg 20 ug
$737.00
TP321253 Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 2, 20 µg 20 ug
$737.00
TP721021 Purified recombinant protein of Human copine I (CPNE1), transcript variant 5 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products