CPNE1 (NM_152925) Human Recombinant Protein

SKU
TP312892
Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212892 representing NM_152925
Red=Cloning site Green=Tags(s)

MAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELGRTERVRNCSSPEFSKTLQLEYRFET
VQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGKPAGRGTITVSAQELKDNRVV
TMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
QCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMG
GCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ
VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLL
TDGAVTDVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQ
NAPREALAQTVLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_690902
Locus ID 8904
UniProt ID Q99829
Cytogenetics 20q11.22
RefSeq Size 2022
RefSeq ORF 1611
Synonyms COPN1; CPN1
Summary Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq, Aug 2008]
Write Your Own Review
You're reviewing:CPNE1 (NM_152925) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312736 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690905) 10 ug
$3,255.00
PH312892 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690902) 10 ug
$3,255.00
PH321043 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690906) 10 ug
$3,255.00
PH321253 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690903) 10 ug
$3,255.00
PH323828 CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690904) 10 ug
$3,255.00
LC407221 CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407223 CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407224 CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407221 Transient overexpression lysate of copine I (CPNE1), transcript variant 2 100 ug
$436.00
LY407223 Transient overexpression lysate of copine I (CPNE1), transcript variant 5 100 ug
$436.00
LY407224 Transient overexpression lysate of copine I (CPNE1), transcript variant 6 100 ug
$436.00
TP312736 Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 5, 20 µg 20 ug
$737.00
TP321043 Recombinant protein of human copine I (CPNE1), transcript variant 6, 20 µg 20 ug
$737.00
TP321253 Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 2, 20 µg 20 ug
$737.00
TP323828 Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 4, 20 µg 20 ug
$737.00
TP721021 Purified recombinant protein of Human copine I (CPNE1), transcript variant 5 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.