OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Casein (CSN1S1) (NM_001890) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323721
Recombinant protein of human casein alpha s1 (CSN1S1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Casein or NM_001890"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223721 protein sequence
Red=Cloning site Green=Tags(s)

MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE
STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN
QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001881
Locus ID 1446
UniProt ID P47710
Cytogenetics 4q13.3
RefSeq Size 981
RefSeq ORF 555
Synonyms CASA; CSN1
Summary Important role in the capacity of milk to transport calcium phosphate.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Casein" proteins (5)
SKU Description Size Price
PH323721 CSN1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001881) 10 ug
$3,360.00
LC419687 Lyophilized CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422589 Lyophilized CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419687 Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422589 Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products