OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFNA4 (NM_021068) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323649
Recombinant protein of human interferon, alpha 4 (IFNA4), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA325190 IFNA4 Antibody (C-term)
400 ul
$645.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IFNA4 or NM_021068"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223649 protein sequence
Red=Cloning site Green=Tags(s)

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQ
FQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI
LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_066546
Locus ID 3441
UniProt ID P05014
Cytogenetics 9p21.3
RefSeq Size 982
RefSeq ORF 567
Synonyms IFN-alpha4a; INFA4
Summary Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFNA4" proteins (4)
SKU Description Size Price
PH323649 IFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_066546) 10 ug
$3,360.00
LC412102 Lyophilized IFNA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412102 Transient overexpression lysate of interferon, alpha 4 (IFNA4) (as WB positive control) 100 ug
$436.00
TP721075 Purified recombinant protein of Human interferon, alpha 4 (IFNA4) 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products