OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRTM2 (NM_001039029) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323599
Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LRTM2 or NM_001039029"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223599 representing NM_001039029
Red=Cloning site Green=Tags(s)

MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAAT
RTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSP
LLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFK
HWMEWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPK
PGAEPEPEPSTACPQKQRHRPASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQ
PLMGDPEGEHEDQKQISSVA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001034118
Locus ID 654429
UniProt ID Q8N967
Cytogenetics 12p13.33
RefSeq Size 3688
RefSeq ORF 1110
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRTM2" proteins (8)
SKU Description Size Price
PH323599 LRTM2 MS Standard C13 and N15-labeled recombinant protein (NP_001034118) 10 ug
$3,360.00
LC422012 Lyophilized LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431881 Lyophilized LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431882 Lyophilized LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422012 Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431881 Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431882 Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP328853 Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products