LRTM2 (NM_001039029) Human Mass Spec Standard

SKU
PH323599
LRTM2 MS Standard C13 and N15-labeled recombinant protein (NP_001034118)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223599]
Predicted MW 41 kDa
Protein Sequence
Protein Sequence
>RC223599 representing NM_001039029
Red=Cloning site Green=Tags(s)

MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAAT
RTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSP
LLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFK
HWMEWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPK
PGAEPEPEPSTACPQKQRHRPASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQ
PLMGDPEGEHEDQKQISSVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034118
RefSeq Size 3688
RefSeq ORF 1110
Locus ID 654429
UniProt ID Q8N967
Cytogenetics 12p13.33
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LRTM2 (NM_001039029) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422012 LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431881 LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431882 LRTM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422012 Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 1 100 ug
$436.00
LY431881 Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2 100 ug
$436.00
LY431882 Transient overexpression lysate of leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 3 100 ug
$436.00
TP323599 Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), 20 µg 20 ug
$737.00
TP328853 Recombinant protein of human leucine-rich repeats and transmembrane domains 2 (LRTM2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.