RANBP1 (NM_002882) Human Recombinant Protein
CAT#: TP323305
Recombinant protein of human RAN binding protein 1 (RANBP1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223305 representing NM_002882
Red=Cloning site Green=Tags(s) MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKER GTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAI RFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002873 |
Locus ID | 5902 |
UniProt ID | P04049, P43487, L7RRS6, A0A140VK94 |
Cytogenetics | 22q11.21 |
Refseq Size | 884 |
Refseq ORF | 603 |
Synonyms | HTF9A |
Summary | This gene encodes a protein that forms a complex with Ras-related nuclear protein (Ran) and metabolizes guanoside triphosphate (GTP). This complex participates in the regulation of the cell cycle by controlling transport of proteins and nucleic acids into the nucleus. There are multiple pseudogenes for this gene on chromosomes 9, 12, 17, and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401015 | RANBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401015 | Transient overexpression lysate of RAN binding protein 1 (RANBP1) |
USD 436.00 |
|
PH323305 | RANBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002873) |
USD 3,255.00 |
|
TP710020 | Recombinant protein of human v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1),residues Ser306-Phe648, with N-terminal polyhistidine tag,expressed in sf9 cells |
USD 515.00 |
|
TP760657 | Purified recombinant protein of Human RAN binding protein 1 (RANBP1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review