OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKDD1A (NM_182703) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323253
Recombinant protein of human ankyrin repeat and death domain containing 1A (ANKDD1A), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359037 ANKDD1A Antibody - C-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ANKDD1A or NM_182703"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223253 representing NM_182703
Red=Cloning site Green=Tags(s)

MQEELAWETDGLLPLERQLHEAARQNNVGRMQELIGRRVNTRARNHVGRVALHWAAGAGHEQAVRLLLEH
EAAVDEEDAVGALTEARLCFGMNALLLSAWFGHLRILQILVNSGAKIHCESKDGLTLLHCAAQKGHVPVL
AFIMEDLEDVALDHVDKLGRTAFHRAAEHGQLDALDFLVGSGCDHNVKDKEGNTALHLAAGRGHMAVLQR
LVDIGLDLEEQNAEGLTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHA
GGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAVDNRQQTPLHLAAEHAWQDIADMLLIAGVDL
NLRDKQGKTALAVAVRSNHVSLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS
RYLQPREWKKLAYSWEFTEAHVDAIEQQWTGTRSYQEHGHRMLLIWLHGVATAGENPSKALFEGLVAIGR
RDLAGWSTMARSQLTATSASRVQMILVPQPPE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_874362
Locus ID 348094
UniProt ID Q495B1
Cytogenetics 15q22.31
RefSeq Size 3126
RefSeq ORF 1566
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKDD1A" proteins (3)
SKU Description Size Price
PH323253 ANKDD1A MS Standard C13 and N15-labeled recombinant protein (NP_874362) 10 ug
$3,360.00
LC405417 Lyophilized ANKDD1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405417 Transient overexpression lysate of ankyrin repeat and death domain containing 1A (ANKDD1A) (as WB positive control) 100 ug
$665.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products