DCTD (NM_001012732) Human Recombinant Protein

SKU
TP323090
Recombinant protein of human dCMP deaminase (DCTD), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223090 representing NM_001012732
Red=Cloning site Green=Tags(s)

MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG
CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS
DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001012750
Locus ID 1635
UniProt ID P32321
Cytogenetics 4q35.1
RefSeq Size 2042
RefSeq ORF 567
Summary The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Write Your Own Review
You're reviewing:DCTD (NM_001012732) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317231 DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912) 10 ug
$3,255.00
PH323090 DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001012750) 10 ug
$3,255.00
LC419656 DCTD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422825 DCTD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419656 Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 2 100 ug
$436.00
LY422825 Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 1 100 ug
$436.00
TP317231 Recombinant protein of human dCMP deaminase (DCTD), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.