DCTD (NM_001012732) Human Mass Spec Standard

SKU
PH323090
DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001012750)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223090]
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC223090 representing NM_001012732
Red=Cloning site Green=Tags(s)

MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG
CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS
DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012750
RefSeq Size 2042
RefSeq ORF 567
Locus ID 1635
UniProt ID P32321
Cytogenetics 4q35.1
Summary The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Write Your Own Review
You're reviewing:DCTD (NM_001012732) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317231 DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912) 10 ug
$3,255.00
LC419656 DCTD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422825 DCTD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419656 Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 2 100 ug
$436.00
LY422825 Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 1 100 ug
$436.00
TP317231 Recombinant protein of human dCMP deaminase (DCTD), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323090 Recombinant protein of human dCMP deaminase (DCTD), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.