OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JNK1 (MAPK8) (NM_139049) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322925
Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500081 JNK1 (MAPK8) mouse monoclonal antibody, clone OTI4E3 (formerly 4E3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "JNK1 or NM_139049"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222925 representing NM_139049
Red=Cloning site Green=Tags(s)

MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRA
YRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK
HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWS
VGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLF
PADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE
EWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_620637
Locus ID 5599
UniProt ID P45983
Cytogenetics 10q11.22
RefSeq Size 1412
RefSeq ORF 1281
Synonyms JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Summary The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. provided by RefSeq, Apr 2016
Protein Categories Enzyme: Kinases, Intracellular Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
Protein Pathways Adipocytokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, GnRH signaling pathway, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JNK1" proteins (15)
SKU Description Size Price
PH318407 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_002741) 10 ug
$3,360.00
PH322829 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620634) 10 ug
$3,360.00
PH322874 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620635) 10 ug
$3,360.00
PH322925 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620637) 10 ug
$3,360.00
LC400970 Lyophilized MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408400 Lyophilized MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408401 Lyophilized MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408403 Lyophilized MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400970 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1 (as WB positive control) 100 ug
$436.00
LY408400 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1 (as WB positive control) 100 ug
$436.00
LY408401 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2 (as WB positive control) 100 ug
$665.00
LY408403 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2 (as WB positive control) 100 ug
$665.00
TP318407 Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, 20 µg 20 ug
$867.00
TP322829 Purified recombinant protein of Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, 20 µg 20 ug
$867.00
TP322874 Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, 20 µg 20 ug
$867.00

file-alt Citations

Stanniocalcin-1 Promotes PARP1-Dependent Cell Death via JNK Activation in Colitis
Zhu, Xie, Yang et al
Adv Sci (Weinh) (2023)
Cited by 23
AI Summary: OriGene's recombinant human JNK protein (#TP322925) was used as a prey protein in pull-down assays to investigate protein interactions central to the study's findings on STC1-mediated cell death in colitis.
Snippet: … Purified recombinant human His-tagged PARP1 protein (11040-H08B;SinoBiological, China) was used as a bait protein. Recombinant human STC1 protein (#ab63280, Abcam, UK) and JNK protein (#TP322925, Origene, China) were prey proteins. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products