JNK1 (MAPK8) (NM_002750) Human Recombinant Protein

SKU
TP318407
Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218407 representing NM_002750
Red=Cloning site Green=Tags(s)

MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRA
YRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK
HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWS
VGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLF
PADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE
EWKELIYKEVMDLEERTKNGVIRGQPSPLAQVQQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002741
Locus ID 5599
UniProt ID P45983
Cytogenetics 10q11.22
RefSeq Size 1417
RefSeq ORF 1152
Synonyms JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c
Summary The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Apr 2016]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
Protein Pathways Adipocytokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, GnRH signaling pathway, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, Wnt signaling pathway
Write Your Own Review
You're reviewing:JNK1 (MAPK8) (NM_002750) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318407 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_002741) 10 ug
$3,255.00
PH322829 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620634) 10 ug
$3,255.00
PH322874 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620635) 10 ug
$3,255.00
PH322925 MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620637) 10 ug
$3,255.00
LC400970 MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408400 MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408401 MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408403 MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430088 MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400970 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1 100 ug
$436.00
LY408400 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1 100 ug
$436.00
LY408401 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2 100 ug
$665.00
LY408403 Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2 100 ug
$665.00
TP322829 Purified recombinant protein of Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322874 Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322925 Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.