OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PICK1 (NM_001039583) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322916
Recombinant protein of human protein interacting with PRKCA 1 (PICK1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA350769 Rabbit Polyclonal Anti-PICK1 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PICK1 or NM_001039583"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222916 protein sequence
Red=Cloning site Green=Tags(s)

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI
TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS
RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKF
ADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIAL
GEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA
VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001034672
Locus ID 9463
UniProt ID Q9NRD5
Cytogenetics 22q13.1
RefSeq Size 2126
RefSeq ORF 1245
Synonyms PICK; PRKCABP
Summary The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PICK1" proteins (13)
SKU Description Size Price
PH303455 PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034673) 10 ug
$3,360.00
PH322869 PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_036539) 10 ug
$3,360.00
PH322916 PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034672) 10 ug
$3,360.00
LC415785 Lyophilized PICK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422082 Lyophilized PICK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422083 Lyophilized PICK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425646 Lyophilized PICK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415785 Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422082 Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422083 Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY425646 Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP303455 Purified recombinant protein of Homo sapiens protein interacting with PRKCA 1 (PICK1), transcript variant 3, 20 µg 20 ug
$867.00
TP322869 Recombinant protein of human protein interacting with PRKCA 1 (PICK1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products