OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEC13L1 (SEC13) (NM_183352) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322811
Recombinant protein of human SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA308045 Rabbit Polyclonal antibody to SEC13L1 (SEC13 homolog (S. cerevisiae))
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SEC13L1 or NM_183352"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222811 protein sequence
Red=Cloning site Green=Tags(s)

MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY
GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW
EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA
HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS
GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_899195
Locus ID 6396
UniProt ID P55735
Cytogenetics 3p25.3
RefSeq Size 1437
RefSeq ORF 966
Synonyms D3S1231E; npp-20; SEC13L1; SEC13R
Summary The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. provided by RefSeq, Oct 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEC13L1" proteins (5)
SKU Description Size Price
PH322811 SEC13 MS Standard C13 and N15-labeled recombinant protein (NP_899195) 10 ug
$3,360.00
LC405245 Lyophilized SEC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427864 Lyophilized SEC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405245 Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427864 Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products