SEC13L1 (SEC13) (NM_183352) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222811] |
Predicted MW | 35.5 kDa |
Protein Sequence |
Protein Sequence
>RC222811 protein sequence
Red=Cloning site Green=Tags(s) MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_899195 |
RefSeq Size | 1437 |
RefSeq ORF | 966 |
Synonyms | D3S1231E; npp-20; SEC13L1; SEC13R |
Locus ID | 6396 |
UniProt ID | P55735 |
Cytogenetics | 3p25.3 |
Summary | The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC405245 | SEC13 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427864 | SEC13 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405245 | Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1 | 100 ug |
$436.00
|
|
LY427864 | Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 2 | 100 ug |
$436.00
|
|
TP322811 | Recombinant protein of human SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.