SEC13L1 (SEC13) (NM_183352) Human Mass Spec Standard

SKU
PH322811
SEC13 MS Standard C13 and N15-labeled recombinant protein (NP_899195)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222811]
Predicted MW 35.5 kDa
Protein Sequence
Protein Sequence
>RC222811 protein sequence
Red=Cloning site Green=Tags(s)

MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY
GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW
EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA
HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS
GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899195
RefSeq Size 1437
RefSeq ORF 966
Synonyms D3S1231E; npp-20; SEC13L1; SEC13R
Locus ID 6396
UniProt ID P55735
Cytogenetics 3p25.3
Summary The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008]
Write Your Own Review
You're reviewing:SEC13L1 (SEC13) (NM_183352) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405245 SEC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427864 SEC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405245 Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1 100 ug
$436.00
LY427864 Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 2 100 ug
$436.00
TP322811 Recombinant protein of human SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.