OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEC13L1 (SEC13) (NM_183352) Human Mass Spec Standard

Be the first to review this product
SKU
PH322811
SEC13 MS Standard C13 and N15-labeled recombinant protein (NP_899195)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308045 Rabbit Polyclonal antibody to SEC13L1 (SEC13 homolog (S. cerevisiae))
100 ul
$665.00
LY405245 Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SEC13L1 or NM_183352"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222811
Predicted MW 35.5 kDa
Protein Sequence
Protein Sequence
>RC222811 protein sequence
Red=Cloning site Green=Tags(s)

MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY
GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW
EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA
HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS
GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899195
RefSeq Size 1437
RefSeq ORF 966
Synonyms D3S1231E; npp-20; SEC13L1; SEC13R
Locus ID 6396
UniProt ID P55735
Cytogenetics 3p25.3
Summary The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEC13L1" proteins (5)
SKU Description Size Price
LC405245 Lyophilized SEC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427864 Lyophilized SEC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405245 Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427864 Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP322811 Recombinant protein of human SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products