WDR51A (POC1A) (NM_015426) Human Recombinant Protein
CAT#: TP322704
Recombinant protein of human WD repeat domain 51A (WDR51A), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222704 protein sequence
Red=Cloning site Green=Tags(s) MAAPCAEDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFS PSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFS LSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNT VKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFS RTGEYFASGGSDEQVMVWKSNFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQ EPVSVPQTLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQCLENQQLIMQRATP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056241 |
Locus ID | 25886 |
UniProt ID | Q8NBT0 |
Cytogenetics | 3p21.2 |
Refseq Size | 2213 |
Refseq ORF | 1221 |
Synonyms | PIX2; SOFT; WDR51A |
Summary | POC1 proteins contain an N-terminal WD40 domain and a C-terminal coiled coil domain and are part of centrosomes. They play an important role in basal body and cilia formation. This gene encodes one of the two POC1 proteins found in humans. Mutations in this gene result in short stature, onychodysplasia, facial dysmorphism, and hypotrichosis (SOFT) syndrome. [provided by RefSeq, Sep 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414586 | POC1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431870 | POC1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414586 | Transient overexpression lysate of WD repeat domain 51A (WDR51A), transcript variant 1 |
USD 436.00 |
|
LY431870 | Transient overexpression lysate of POC1 centriolar protein homolog A (Chlamydomonas) (POC1A), transcript variant 2 |
USD 436.00 |
|
PH322704 | POC1A MS Standard C13 and N15-labeled recombinant protein (NP_056241) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review