WDR51A (POC1A) (NM_015426) Human Mass Spec Standard

SKU
PH322704
POC1A MS Standard C13 and N15-labeled recombinant protein (NP_056241)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222704]
Predicted MW 45 kDa
Protein Sequence
Protein Sequence
>RC222704 protein sequence
Red=Cloning site Green=Tags(s)

MAAPCAEDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFS
PSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFS
LSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNT
VKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFS
RTGEYFASGGSDEQVMVWKSNFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQ
EPVSVPQTLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQCLENQQLIMQRATP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056241
RefSeq Size 2213
RefSeq ORF 1221
Synonyms PIX2; SOFT; WDR51A
Locus ID 25886
UniProt ID Q8NBT0
Cytogenetics 3p21.2
Summary POC1 proteins contain an N-terminal WD40 domain and a C-terminal coiled coil domain and are part of centrosomes. They play an important role in basal body and cilia formation. This gene encodes one of the two POC1 proteins found in humans. Mutations in this gene result in short stature, onychodysplasia, facial dysmorphism, and hypotrichosis (SOFT) syndrome. [provided by RefSeq, Sep 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:WDR51A (POC1A) (NM_015426) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414586 POC1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431870 POC1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414586 Transient overexpression lysate of WD repeat domain 51A (WDR51A), transcript variant 1 100 ug
$436.00
LY431870 Transient overexpression lysate of POC1 centriolar protein homolog A (Chlamydomonas) (POC1A), transcript variant 2 100 ug
$436.00
TP322704 Recombinant protein of human WD repeat domain 51A (WDR51A), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.