OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

kynurenine 3 monooxygenase (KMO) (NM_003679) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322594
Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA325062 KMO Antibody (Center)
400 ul
$645.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "kynurenine 3 monooxygenase or NM_003679"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222594 representing NM_003679
Red=Cloning site Green=Tags(s)

MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG
LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN
PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP
NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL
PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI
PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLCLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.6 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity The specific activity of KMO was determined by measuring the product 3-hydroxykynurenine formation from a conversion of Kynurenine. The reaction was carried out at 37 ? for 40min in the buffer containing 100 mM Tris, pH8.0, 10 mM KCl, 1 mM NADPH, 3 mM glucose-6-phos-phate, 1 units/ml of glucose-6 phosphate dehydrogenase, and 100 ?M kynurenine as the substrate
Surface Plasmon Ressonance (SPR) (PMID: 26292018)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003670
Locus ID 8564
UniProt ID O15229
Cytogenetics 1q43
RefSeq Size 4992
RefSeq ORF 1458
Synonyms dJ317G22.1
Summary This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. provided by RefSeq, Oct 2011
Protein Categories Membrane Proteins
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Tryptophan metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "kynurenine 3 monooxygenase" proteins (6)
SKU Description Size Price
PH322594 KMO MS Standard C13 and N15-labeled recombinant protein (NP_003670) 10 ug
$3,360.00
LC401216 Lyophilized KMO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401216 Transient overexpression lysate of kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO) (as WB positive control) 100 ug
$665.00
TP700071 Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with C-terminal AVI tag (GGGLNDIFEAQKIEWHE) prior to MYC/DDK tag, expressed in human cells, 20ug 20 ug
$900.00
TP700072 Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with N-terminal AVI tag (MSGLNDIFEAQKIEWHEAIA) and C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$900.00
TP710125 Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

Kynurenine 3-Monooxygenase Interacts with Huntingtin at the Outer Mitochondrial Membrane
Swaih, Breda, Sathyasaikumar et al
Biomedicines (2022) 10 (9) DOI: 10.3390/biomedicines10092294
Cited by 10
AI Summary: OriGene contributed to this study by providing the full-length human KMO cDNA (product: TP322594), which was used to investigate the interaction between KMO and huntingtin in cellular models.
Snippet: gregates, suggesting that aggregation sequesters HTT away from normal interactions with KMO. 2. Methods 2.1. Construction of KMO and HTT Plasmids Full length human KMO (flKMO) cDNA was obtained from Origene (TP322594) (GenBank accession: NM_003679), and truncated KMO (tKMO) cDNA was sourced from Gene Service (clone 3934714). tKMO resembles the KMO splice isoform 2 with a C-terminal truncation, re
FigureFigureFigure
Full-length in meso structure and mechanism of rat kynurenine 3-monooxygenase inhibition
Mimasu, Yamagishi, Kubo et al
Commun Biol (2021) 4 (1), 159 DOI: 10.1038/s42003-021-01666-5
Cited by 7
AI Summary: OriGene's human KMO protein was used to assay inhibitor compounds in this study, contributing to the characterization of KMO inhibition mechanisms.
Snippet: d kynurenine was the top ranked structure. Human and rat KMO enzyme assay All information relevant to compound synthesis of compounds 1–5 are in Supplementary Note 1. Human KMO was purchased from Origene and used to assay compounds. Full-length Rat-KMO purified for crystallisation was used to assay compounds. Full-length Rat-KMO-expressing membranes were used for mutant assays (Fig. 4b) only
FigureFigureFigure
Development of a Surface Plasmon Resonance Assay for the Characterization of Small-Molecule Binding Kinetics and Mechanism of Binding to Kynurenine 3-Monooxygenase
Poda, Kobayashi, Nachane et al
Assay Drug Dev Technol (2015)
Cited by 2
AI Summary: OriGene contributed to this study by providing a full-length KMO protein (expressed in HEK293 cells), which was used for developing and optimizing the surface plasmon resonance assay to characterize KMO inhibitor binding kinetics and mechanisms.
Snippet: The enzyme was purified by a three-step chromatographic procedure comprising affinity chromatography and size exclusion chromatography steps. A full-length KMO without GST expressed in HEK293s cells was purchased from Origene. ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products