kynurenine 3 monooxygenase (KMO) (NM_003679) Human Mass Spec Standard

SKU
PH322594
KMO MS Standard C13 and N15-labeled recombinant protein (NP_003670)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222594]
Predicted MW 55.6 kDa
Protein Sequence
Protein Sequence
>RC222594 representing NM_003679
Red=Cloning site Green=Tags(s)

MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG
LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN
PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP
NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL
PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI
PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLCLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003670
RefSeq Size 4992
RefSeq ORF 1458
Synonyms dJ317G22.1
Locus ID 8564
UniProt ID O15229
Cytogenetics 1q43
Summary This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Tryptophan metabolism
Write Your Own Review
You're reviewing:kynurenine 3 monooxygenase (KMO) (NM_003679) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401216 KMO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401216 Transient overexpression lysate of kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO) 100 ug
$665.00
TP322594 Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP700071 Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with C-terminal AVI tag (GGGLNDIFEAQKIEWHE) prior to MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP700072 Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with N-terminal AVI tag (MSGLNDIFEAQKIEWHEAIA) and C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00
TP710125 Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.