SFTPA2B (NM_006926) Human Recombinant Protein

CAT#: TP321900

Recombinant protein of human surfactant protein A2B (SFTPA2B), 20 µg

Product Images

Coomassie blue staining of purified SFTPA2B protein (Cat# TP321900). The protein was produced from HEK293T cells transfected with SFTPA2B cDNA clone (Cat# RC221900) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221900 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPP
  GNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFS
  SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTN
  WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008857
• Locus ID: 6436
• Cytogenetics: 10q22.3
• Refseq Size: 2190
• Refseq ORF: 744
• Synonyms: AC068139.3; SFTPA2; SP-2A; SP-A1; SP-A2; SPAII
• Summary: DISCONTINUED: This record has been withdrawn by the HUGO Gene Nomenclature Committee (HGNC), and it has been determined that the sequence is redundant with SFTPA2 (GeneID:729238) in the GRCh37.1 reference assembly.
• Protein Families: Secreted Protein