OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RWDD1 (NM_001007464) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321813
Recombinant protein of human RWD domain containing 1 (RWDD1), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA365351 RWDD1 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RWDD1 or NM_001007464"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221813 protein sequence
Red=Cloning site Green=Tags(s)

MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIF
SQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQL
FHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEV
DESLFQEMDDLELEDDEDDPDYNPADPESDSAD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001007465
Locus ID 51389
UniProt ID Q9H446
Cytogenetics 6q22.1
RefSeq Size 1562
RefSeq ORF 729
Synonyms CGI-24; PTD013
Summary Protects DRG2 from proteolytic degradation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RWDD1" proteins (5)
SKU Description Size Price
PH321813 RWDD1 MS Standard C13 and N15-labeled recombinant protein (NP_001007465) 10 ug
$3,360.00
LC414180 Lyophilized RWDD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423486 Lyophilized RWDD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414180 Transient overexpression lysate of RWD domain containing 1 (RWDD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423486 Transient overexpression lysate of RWD domain containing 1 (RWDD1), transcript variant 3 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products