OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPEB4 (NM_030627) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321803
Recombinant protein of human cytoplasmic polyadenylation element binding protein 4 (CPEB4), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370030 CPEB4 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CPEB4 or NM_030627"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221803 representing NM_030627
Red=Cloning site Green=Tags(s)

MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAWLFPAPATHNI
QDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDNSSENGNGKEKIRIESPVL
TGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPAASANNGALLFQNF
PHHVSPGFGGSFSPQIGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNK
PPSPWSSYQSPSPTPSSSWSPGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYAR
PSSAFAPKSWMEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINA
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITA
SFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFS
NQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAA
IHSRAGREFHKPLVKEGGDRPRHISFRWN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 80 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_085130
Locus ID 80315
UniProt ID Q17RY0
Cytogenetics 5q35.2
RefSeq Size 6930
RefSeq ORF 2187
Synonyms CPE-BP4; hCPEB-4
Summary Sequence-specific RNA-binding protein that binds to the cytoplasmic polyadenylation element (CPE), an uridine-rich sequence element (consensus sequence 5'-UUUUUAU-3') within the mRNA 3' UTR (PubMed:24990967). RNA binding results in a clear conformational change analogous to the Venus fly trap mechanism (PubMed:24990967). Regulates activation of unfolded protein response (UPR) in the process of adaptation to ER stress in liver, by maintaining translation of CPE-regulated mRNAs in conditions in which global protein synthesis is inhibited (By similarity). Required for cell cycle progression, specifically for cytokinesis and chromosomal segregation (PubMed:26398195). Plays a role as an oncogene promoting tumor growth and progression by positively regulating translation of t-plasminogen activator/PLAT (PubMed:22138752). Stimulates proliferation of melanocytes (PubMed:27857118). In contrast to CPEB1 and CPEB3, does not play role in synaptic plasticity, learning and memory (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CPEB4" proteins (3)
SKU Description Size Price
PH321803 CPEB4 MS Standard C13 and N15-labeled recombinant protein (NP_085130) 10 ug
$3,360.00
LC403071 Lyophilized CPEB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403071 Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 4 (CPEB4) (as WB positive control) 100 ug
$665.00

file-alt Citations

System Biology-Guided Chemical Proteomics to Discover Protein Targets of Monoethylhexyl Phthalate in Regulating Cell Cycle
Xu, Chen, Lim et al
Environ Sci Technol (2021) 55 (3), 1842-1851 DOI: 10.1021/acs.est.0c05832
Cited by 30
AI Summary: OriGene contributed to this study by providing recombinant ANAPC5 and CPEB4 proteins, which were used for target validation of MEHP's effects on cell cycle regulation.
Snippet: … These methods have great potential to be applied as environmental toxicants to f...;was expressed and purified in our large-scale expression (LEX) system, with the detailed methods for the protein expression and purification provided in Text S1. Anaphase-promoting complex subunit 5 (ANAPC5) and cytoplasmic polyadenylation element-binding protein 4 (CPEB4) were purchased from OriGene Technologies Inc. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products