OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HES2 (NM_019089) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321455
Recombinant protein of human hairy and enhancer of split 2 (Drosophila) (HES2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HES2 or NM_019089"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221455 representing NM_019089
Red=Cloning site Green=Tags(s)

MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQEL
PASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSGPS
APAPAPASAPEPASAPVPSPPSPPCGPGLWRPW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_061962
Locus ID 54626
UniProt ID Q9Y543
Cytogenetics 1p36.31
RefSeq Size 4259
RefSeq ORF 519
Synonyms bHLHb40
Summary Transcriptional repressor of genes that require a bHLH protein for their transcription.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HES2" proteins (3)
SKU Description Size Price
PH321455 HES2 MS Standard C13 and N15-labeled recombinant protein (NP_061962) 10 ug
$3,360.00
LC412771 Lyophilized HES2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412771 Transient overexpression lysate of hairy and enhancer of split 2 (Drosophila) (HES2) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products