OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EOLA1 (NM_178124) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321372
Recombinant protein of human chromosome X open reading frame 40A (CXorf40A), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA331320 Rabbit Polyclonal Anti-CXorf40A Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EOLA1 or NM_178124"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221372 protein sequence
Red=Cloning site Green=Tags(s)

MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQA
LLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGK
DVFQVDIPEHLIPLGHEV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835225
Locus ID 91966
UniProt ID Q8TE69
Cytogenetics Xq28
RefSeq Size 2436
RefSeq ORF 474
Synonyms CXorf40; CXorf40A
Summary May have an important role of cell protection in inflammation reaction.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EOLA1" proteins (5)
SKU Description Size Price
PH321372 CXorf40A MS Standard C13 and N15-labeled recombinant protein (NP_835225) 10 ug
$3,360.00
LC406036 Lyophilized CXorf40A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432583 Lyophilized CXorf40A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406036 Transient overexpression lysate of chromosome X open reading frame 40A (CXorf40A), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432583 Transient overexpression lysate of chromosome X open reading frame 40A (CXorf40A), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products