PACAP (ADCYAP1) (NM_001099733) Human Recombinant Protein

CAT#: TP321298

Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified ADCYAP1 protein (Cat# TP321298). The protein was produced from HEK293T cells transfected with ADCYAP1 cDNA clone (Cat# RC221298) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221298 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA
  AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS
  YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001093203
• Locus ID: 116
• UniProt ID: P18509
• Cytogenetics: 18p11.32
• Refseq Size: 3187
• Refseq ORF: 528
• Synonyms: PACAP
• Summary: This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
• Protein Families: Secreted Protein