PACAP (ADCYAP1) (NM_001117) Human Mass Spec Standard

SKU
PH310851
ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001108)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210851]
Predicted MW 18.8 kDa
Protein Sequence
Protein Sequence
>RC210851 protein sequence
Red=Cloning site Green=Tags(s)

MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA
AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS
YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001108
RefSeq Size 3259
RefSeq ORF 528
Synonyms PACAP
Locus ID 116
UniProt ID P18509
Cytogenetics 18p11.32
Summary This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:PACAP (ADCYAP1) (NM_001117) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321298 ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203) 10 ug
$3,255.00
LC400450 ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420506 ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426082 ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400450 Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2 100 ug
$436.00
LY420506 Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 100 ug
$436.00
LY426082 Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 100 ug
$436.00
TP310851 Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, 20 µg 20 ug
$737.00
TP321298 Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.