PACAP (ADCYAP1) (NM_001117) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210851] |
Predicted MW | 18.8 kDa |
Protein Sequence |
Protein Sequence
>RC210851 protein sequence
Red=Cloning site Green=Tags(s) MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001108 |
RefSeq Size | 3259 |
RefSeq ORF | 528 |
Synonyms | PACAP |
Locus ID | 116 |
UniProt ID | P18509 |
Cytogenetics | 18p11.32 |
Summary | This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013] |
Protein Families | Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321298 | ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203) | 10 ug |
$3,255.00
|
|
LC400450 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420506 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426082 | ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400450 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2 | 100 ug |
$436.00
|
|
LY420506 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 | 100 ug |
$436.00
|
|
LY426082 | Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 | 100 ug |
$436.00
|
|
TP310851 | Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP321298 | Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.