OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PACAP (ADCYAP1) (NM_001117) Human Mass Spec Standard

Be the first to review this product
SKU
PH310851
ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001108)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400450 Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PACAP or NM_001117"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210851
Predicted MW 18.8 kDa
Protein Sequence
Protein Sequence
>RC210851 protein sequence
Red=Cloning site Green=Tags(s)

MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA
AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS
YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001108
RefSeq Size 3259
RefSeq ORF 528
Synonyms PACAP
Locus ID 116
UniProt ID P18509
Cytogenetics 18p11.32
Summary This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2013
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PACAP" proteins (9)
SKU Description Size Price
PH321298 ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203) 10 ug
$3,360.00
LC400450 Lyophilized ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420506 Lyophilized ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426082 Lyophilized ADCYAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400450 Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420506 Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426082 Transient overexpression lysate of adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310851 Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 2, 20 µg 20 ug
$737.00
TP321298 Recombinant protein of human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products