BLOC1S3 (NM_212550) Human Recombinant Protein

CAT#: TP321221

Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 3 (BLOC1S3), 20 µg

Product Images

Coomassie blue staining of purified BLOC1S3 protein (Cat# TP321221). The protein was produced from HEK293T cells transfected with BLOC1S3 cDNA clone (Cat# RC221221) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221221 representing NM_212550
  Red=Cloning site Green=Tags(s)
  
  MASQGRRRRPLRRPETVVPGEATETDSERSASSSEEEELYLGPSGPTRGRPTGLRVAGEAAETDSEPEPE
  PEPTAAPRDLPPLVVQRESAEEAWGTEEAPAPAPARSLLQLRLAESQARLDHDVAAAVSGVYRRAGRDVA
  ALASRLAAAQAAGLAAAHSVRLARGDLCALAERLDIVAGCRLLPDIRGVPGTEPEKDPGPRA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_997715
• Locus ID: 388552
• UniProt ID: Q6QNY0
• Cytogenetics: 19q13.32
• Refseq Size: 609
• Refseq ORF: 606
• Synonyms: BLOS3; HPS8; RP
• Summary: This gene encodes a protein that is a component of the BLOC1 multi-subunit protein complex. This complex is necessary for the biogenesis of specialized organelles of the endosomal-lysosomal system, including platelet dense granules and melanosomes. Mutations in this gene cause Hermansky-Pudlak syndrome 8, a disease characterized by lysosomal storage defects, bleeding due to platelet storage pool deficiency, and oculocutaneous albinism. [provided by RefSeq, Jul 2008]