ZNF483 (NM_001007169) Human Recombinant Protein

CAT#: TP320978

Recombinant protein of human zinc finger protein 483 (ZNF483), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified ZNF483 protein (Cat# TP320978). The protein was produced from HEK293T cells transfected with ZNF483 cDNA clone (Cat# RC220978) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220978 representing NM_001007169
  Red=Cloning site Green=Tags(s)
  
  MQAVVPLNKMTAISPEPQTLASTEQNEVPRVVTSGEQEAILRGNAADAESFRQRFRWFCYSEVAGPRKAL
  SQLWELCNQWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESSEEVVTLIEDLTQMLEEKDPV
  SQDSTVSQEENSKEDKMVTVCPNTESCESITLKDVAVNFSRGEWKKLEPFQKELYKEVLLENLRNLEFLD
  FPVSKLELISQLKWVELPWLLEEVSKSSRLDIHGAVKKMQMFSEAE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001007170
• Locus ID: 158399
• UniProt ID: Q8TF39
• Cytogenetics: 9q31.3
• Refseq Size: 2434
• Refseq ORF: 768
• Synonyms: ZKSCAN16; ZSCAN48
• Summary: May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors