TMEM52 (NM_178545) Human Recombinant Protein

CAT#: TP320340

Recombinant protein of human transmembrane protein 52 (TMEM52), 20 µg

Product Images

Coomassie blue staining of purified TMEM52 protein (Cat# TP320340). The protein was produced from HEK293T cells transfected with TMEM52 cDNA clone (Cat# RC220340) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220340 representing NM_178545
  Red=Cloning site Green=Tags(s)
  
  MARGPLAARGLRLLLPLLPLLPLLPLPQVALGFADGSCDPSDQCPPQARWSSLWHVGLILLAVLLLLLCG
  VTAGCVRFCCLRKQAQAQPHLPPARQPCDVAVIPMDSDSPVHSTVTSYSSVQYPLGMRLPLPFGELDLDS
  MAPPAYSLYTPEPPPSYDEAVKMAKPREEGPALSQKPSPLLGASGLETTPVPQESGPNTQLPPCSPGAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848640
• Locus ID: 339456
• UniProt ID: Q8NDY8
• Cytogenetics: 1p36.33
• Refseq Size: 971
• Refseq ORF: 627
• Protein Families: Transmembrane