MZT2A (NM_001085365) Human Recombinant Protein

CAT#: TP319963

Recombinant protein of human family with sequence similarity 128, member A (FAM128A), 20 µg

Product Images

Coomassie blue staining of purified MZT2A protein (Cat# TP319963). The protein was produced from HEK293T cells transfected with MZT2A cDNA clone (Cat# RC219963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219963 representing NM_001085365
  Red=Cloning site Green=Tags(s)
  
  MELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRG
  RDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 16 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001078834
• Locus ID: 653784
• UniProt ID: Q6P582
• Cytogenetics: 2q21.1
• Refseq Size: 708
• Refseq ORF: 363
• Synonyms: FAM128A; MOZART2A