MBNL2 (NM_207304) Human Recombinant Protein

  • Product Brand Image
SKU
TP319730
Recombinant protein of human muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3, 20 µg
In Control Promo
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219730 protein sequence
Red=Cloning site Green=Tags(s)

MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLH
PPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPG
VGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDT
SDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPK
RQALEKSNGTSAVFNPSVLHYQQALTSAQLQQHAAFIPTDNSEIISRNGMECQESALRITKHCYCTYYPV
SSSIELPQTAC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_997187
Locus ID 10150
UniProt ID Q5VZF2
Cytogenetics 13q32.1
RefSeq Size 4624
RefSeq ORF 1083
Synonyms MBLL; MBLL39; PRO2032
Summary This gene is a member of the muscleblind protein family which was initially described in Drosophila melanogaster. This gene encodes a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. provided by RefSeq, Mar 2012
Protein Categories Intracellular Proteins
Protein Families Transcription Factors
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "MBNL2" proteins (5)
SKU Description Size Price
PH319730 MBNL2 MS Standard C13 and N15-labeled recombinant protein (NP_997187) 10 ug
$3,360.00
LC403412 MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404083 MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403412 Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 1 100 ug
$436.00
LY404083 Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.