OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC42SE1 (NM_020239) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319709
Recombinant protein of human CDC42 small effector 1 (CDC42SE1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CDC42SE1 or NM_020239"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219709 protein sequence
Red=Cloning site Green=Tags(s)

MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRD
RPWSNSRGL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064624
Locus ID 56882
UniProt ID Q9NRR8
Cytogenetics 1q21.3
RefSeq Size 3057
RefSeq ORF 237
Synonyms SCIP1; SPEC1
Summary Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDC42SE1" proteins (5)
SKU Description Size Price
PH319709 CDC42SE1 MS Standard C13 and N15-labeled recombinant protein (NP_064624) 10 ug
$3,360.00
LC412574 Lyophilized CDC42SE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422010 Lyophilized CDC42SE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412574 Transient overexpression lysate of CDC42 small effector 1 (CDC42SE1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422010 Transient overexpression lysate of CDC42 small effector 1 (CDC42SE1), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products