OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EEF1G (NM_001404) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319578
Recombinant protein of human eukaryotic translation elongation factor 1 gamma (EEF1G), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA375726 eEF1G Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EEF1G or NM_001404"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219578 representing NM_001404
Red=Cloning site Green=Tags(s)

MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF
ESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILG
LLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLC
EKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPF
AHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLD
KLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE
GAFQHVGKAFNQGKIFK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Biolayer interferometry (BLI) assay (PMID: 26624286)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001395
Locus ID 1937
UniProt ID P26641
Cytogenetics 11q12.3
RefSeq Size 1429
RefSeq ORF 1311
Synonyms EF1G; GIG35
Summary This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EEF1G" proteins (3)
SKU Description Size Price
PH319578 EEF1G MS Standard C13 and N15-labeled recombinant protein (NP_001395) 10 ug
$3,360.00
LC419955 Lyophilized EEF1G HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419955 Transient overexpression lysate of eukaryotic translation elongation factor 1 gamma (EEF1G) (as WB positive control) 100 ug
$436.00

file-alt Citations

Eukaryotic Initiation Translation Factor 2A activation by cannabidiolic acid alters the protein homeostasis balance in glioblastoma cells
Bellone, Syed, Vitale et al
Int J Biol Macromol (2024) 273 (Pt 1), 132968 DOI: 10.1016/j.ijbiomac.2024.132968
Cited by 4
AI Summary: In this study, the OriGene EEF1G protein was used to investigate protein interactions involved in the translation machinery of glioblastoma cells, contributing to the analysis of how cannabidiolic acid activation of EIF2A affects protein homeostasis.
Snippet: Massachusetts, United States). For SPR analysis, EIF2A recombinant protein was purchased by BIOTREND Chemicals, LLC (Miramar Beach, United States). EEF1G was purchased by OriGene Global (Rockville, United States). HBS-EP 10× buffer and CM5 sensor chip were purchased by GE Healthcare (Chicago, IL, United States)
Specific Interaction between eEF1A and HIV RT Is Critical for HIV-1 Reverse Transcription and a Potential Anti-HIV Target
Li, Wei, Rawle et al
PLoS Pathog. (2015) 11 (12), e1005289 DOI: 10.1371/journal.ppat.1005289
Cited by 22
AI Summary: OriGene products, specifically full-length human eEF1A1, eEF1B2, eEF1G, and eEF1D proteins with C-terminal MYC/DDK tags, were used to study and characterize the interaction between eEF1A and HIV-1 reverse transcriptase in this research.
Snippet: Full-length human proteins expressed in HEK293 cells including eEF1A1, 1B2, 1G and 1D proteins having C-terminal MYC/DDK tags were purchased from OriGene (OriGene Technologies, MD, USA) and recombinant 6×His-tagged HIV-1 RT p51, RT p66, IN and Gag ... Cite SaveSaving
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products