HCST (NM_001007469) Human Recombinant Protein

CAT#: TP319253

Recombinant protein of human hematopoietic cell signal transducer (HCST), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified HCST protein (Cat# TP319253). The protein was produced from HEK293T cells transfected with HCST cDNA clone (Cat# RC219253) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219253 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL
  CARPRRSPAQEDGKVYINMPGRG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001007470
• Locus ID: 10870
• UniProt ID: Q9UBK5
• Cytogenetics: 19q13.12
• Refseq Size: 521
• Refseq ORF: 279
• Synonyms: DAP10; KAP10; PIK3AP
• Summary: This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity