OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTUS2 (NM_015233) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319139
Recombinant protein of human KIAA0774 (KIAA0774), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306938 Rabbit Polyclonal CAZIP Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MTUS2 or NM_015233"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219139 representing NM_015233
Red=Cloning site Green=Tags(s)

MGHCCCKPYNCLQCLDKTNESALVKEKELSIELANIRDEVAFHTAKCEKLQKEKEELERRFEDEVKRLGW
QQQAELQELEERLQLQFEAEMARLQEEHGDQLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQD
DHDHKVQELMSTHELEKKELEENFEKLRLSLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAP
YQHLEEDMKSLKQVLEMKNQQIHEQEKKILELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQL
SEENANLQEYVEKETQEKKRLSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056048
Locus ID 23281
UniProt ID Q5JR59
Cytogenetics 13q12.3
RefSeq Size 1779
RefSeq ORF 1044
Synonyms CAZIP; ICIS; KIAA0774; TIP150
Summary Binds microtubules. Together with MAPRE1 may target the microtubule depolymerase KIF2C to the plus-end of microtubules. May regulate the dynamics of microtubules at their growing distal tip.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MTUS2" proteins (5)
SKU Description Size Price
PH319139 MTUS2 MS Standard C13 and N15-labeled recombinant protein (NP_056048) 10 ug
$3,360.00
LC414704 Lyophilized MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422408 Lyophilized MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414704 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422408 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 1 (as WB positive control) 100 ug
$665.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products