MTUS2 (NM_015233) Human Recombinant Protein

SKU
TP319139
Recombinant protein of human KIAA0774 (KIAA0774), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219139 representing NM_015233
Red=Cloning site Green=Tags(s)

MGHCCCKPYNCLQCLDKTNESALVKEKELSIELANIRDEVAFHTAKCEKLQKEKEELERRFEDEVKRLGW
QQQAELQELEERLQLQFEAEMARLQEEHGDQLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQD
DHDHKVQELMSTHELEKKELEENFEKLRLSLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAP
YQHLEEDMKSLKQVLEMKNQQIHEQEKKILELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQL
SEENANLQEYVEKETQEKKRLSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056048
Locus ID 23281
UniProt ID Q5JR59
Cytogenetics 13q12.3
RefSeq Size 1779
RefSeq ORF 1044
Synonyms CAZIP; ICIS; KIAA0774; TIP150
Summary Binds microtubules. Together with MAPRE1 may target the microtubule depolymerase KIF2C to the plus-end of microtubules. May regulate the dynamics of microtubules at their growing distal tip.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MTUS2 (NM_015233) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319139 MTUS2 MS Standard C13 and N15-labeled recombinant protein (NP_056048) 10 ug
$3,255.00
LC414704 MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422408 MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414704 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 2 100 ug
$436.00
LY422408 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.