MTUS2 (NM_015233) Human Mass Spec Standard

SKU
PH319139
MTUS2 MS Standard C13 and N15-labeled recombinant protein (NP_056048)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219139]
Predicted MW 40.6 kDa
Protein Sequence
Protein Sequence
>RC219139 representing NM_015233
Red=Cloning site Green=Tags(s)

MGHCCCKPYNCLQCLDKTNESALVKEKELSIELANIRDEVAFHTAKCEKLQKEKEELERRFEDEVKRLGW
QQQAELQELEERLQLQFEAEMARLQEEHGDQLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQD
DHDHKVQELMSTHELEKKELEENFEKLRLSLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAP
YQHLEEDMKSLKQVLEMKNQQIHEQEKKILELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVVTRQL
SEENANLQEYVEKETQEKKRLSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056048
RefSeq Size 1779
RefSeq ORF 1044
Synonyms CAZIP; ICIS; KIAA0774; TIP150
Locus ID 23281
UniProt ID Q5JR59
Cytogenetics 13q12.3
Summary Binds microtubules. Together with MAPRE1 may target the microtubule depolymerase KIF2C to the plus-end of microtubules. May regulate the dynamics of microtubules at their growing distal tip.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MTUS2 (NM_015233) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414704 MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422408 MTUS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414704 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 2 100 ug
$436.00
LY422408 Transient overexpression lysate of microtubule associated tumor suppressor candidate 2 (MTUS2), transcript variant 1 100 ug
$665.00
TP319139 Recombinant protein of human KIAA0774 (KIAA0774), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.