OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GSDMA (NM_178171) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319050
Recombinant protein of human gasdermin A (GSDMA), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GSDMA or NM_178171"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219050 protein sequence
Red=Cloning site Green=Tags(s)

MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSP
SDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFL
KEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQL
MVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQS
SLLSSLSKLLGKKKELQDLELALEGALDKGHEVNLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLL
VKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMW
DPDTLPRLCALYAGLSLLQQLTKAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835465
Locus ID 284110
UniProt ID Q96QA5
Cytogenetics 17q21.1
RefSeq Size 2164
RefSeq ORF 1335
Synonyms FKSG9; GSDM; GSDM1
Summary May promote pyroptosis (Probable). Upon cleavage in vitro of genetically engineered GSDMA, the released N-terminal moiety binds to some types of lipids, such as possibly phosphatidylinositol (4,5)-bisphosphate. Homooligomerizes within the membrane and forms pores of 10 -15 nanometers (nm) of inner diameter, triggering cell death. Also binds to bacterial and mitochondrial lipids, including cardiolipin, and exhibits bactericidal activity (PubMed:27281216). The physiological relevance of these observations is unknown (Probable).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GSDMA" proteins (3)
SKU Description Size Price
PH319050 GSDMA MS Standard C13 and N15-labeled recombinant protein (NP_835465) 10 ug
$3,360.00
LC406011 Lyophilized GSDMA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406011 Transient overexpression lysate of gasdermin A (GSDMA) (as WB positive control) 100 ug
$665.00

file-alt Citations

Dynamic S-Acylation of GSDMA Regulates Pyroptosis
Tao, Thakare, Cheung et al
ACS Chem Biol (2026) 21 (5), 898-908 DOI: 10.1021/acschembio.5c00050
AI Summary: OriGene’s GSDMA recombinant protein (Cat. #TP319050) was used in this study to investigate the S-acylation of GSDMA and its role in regulating pyroptosis.
Snippet: Tris(2-carboxyethyl)phosphine hydrochloride (TCEP) (Cat. #C4706, Sigma-Aldrich), Copper(II) sulfate (Cat. #496130, Sigma-Aldrich), Tris[(1-benzyl-1H-1,2,3-triazol-4-yl)methyl]amine (TBTA) (Cat. #678937, Sigma-Aldrich), chemical probes (Click Chemistry Tools), Streptavidin Agarose beads (Cat. #SA10004, Life Technologies), cOmplete EDTA-free protease inhibitor cocktail (Cat. #05892791001, Roche), Phosphatase inhibitor cocktail (Cat. #P0044, Sigma-Aldrich), Alkyne Palmitoyl-Coenzyme A (Cat. #15968, Cayman), GSDMA recombinant protein (Cat. #TP319050, Origene), and GSDMD recombinant protein (Cat. #CSB-EP009956HU, COSMO BIO USA)
Dynamic S -acylation of GSDMA regulates pyroptosis
Tao, Thakare, Cheung et al
bioRxiv (2025)
AI Summary: OriGene’s GSDMA recombinant protein (Cat. # TP319050) was used in this study to investigate the S-acylation of GSDMA and its role in regulating pyroptosis.
Snippet: Alkyne Palmitoyl-Coenzyme A (Cat. #15968, Cayman), GSDMA recombinant protein (Cat. # TP319050, Origene), GSDMD recombinant protein (Cat. #CSB-EP009956HU, COSMO BIO USA)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products