GSDMA (NM_178171) Human Mass Spec Standard

SKU
PH319050
GSDMA MS Standard C13 and N15-labeled recombinant protein (NP_835465)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219050]
Predicted MW 49.4 kDa
Protein Sequence
Protein Sequence
>RC219050 protein sequence
Red=Cloning site Green=Tags(s)

MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSP
SDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFL
KEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQL
MVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQS
SLLSSLSKLLGKKKELQDLELALEGALDKGHEVNLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLL
VKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMW
DPDTLPRLCALYAGLSLLQQLTKAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_835465
RefSeq Size 2164
RefSeq ORF 1335
Synonyms FKSG9; GSDM; GSDM1
Locus ID 284110
UniProt ID Q96QA5
Cytogenetics 17q21.1
Summary May promote pyroptosis (Probable). Upon cleavage in vitro of genetically engineered GSDMA, the released N-terminal moiety binds to some types of lipids, such as possibly phosphatidylinositol (4,5)-bisphosphate. Homooligomerizes within the membrane and forms pores of 10 -15 nanometers (nm) of inner diameter, triggering cell death. Also binds to bacterial and mitochondrial lipids, including cardiolipin, and exhibits bactericidal activity (PubMed:27281216). The physiological relevance of these observations is unknown (Probable).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:GSDMA (NM_178171) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406011 GSDMA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406011 Transient overexpression lysate of gasdermin A (GSDMA) 100 ug
$665.00
TP319050 Recombinant protein of human gasdermin A (GSDMA), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.