KCTD2 (NM_015353) Human Recombinant Protein

CAT#: TP318957

Purified recombinant protein of Homo sapiens potassium channel tetramerisation domain containing 2 (KCTD2), 20 µg

Product Images

Coomassie blue staining of purified KCTD2 protein (Cat# TP318957). The protein was produced from HEK293T cells transfected with KCTD2 cDNA clone (Cat# RC218957) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218957 representing NM_015353
  Red=Cloning site Green=Tags(s)
  
  MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPRPAGPTPRGHGRPAAAVAQPLEPGPGPPERAGGGGA
  ARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPILNYLRHGKL
  IITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKF
  EQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSEKAKILQERGSRM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056168
• Locus ID: 23510
• UniProt ID: Q14681, Q8IYY2
• Cytogenetics: 17q25.1
• Refseq Size: 3714
• Refseq ORF: 789