OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PROP1 (NM_006261) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318746
Recombinant protein of human PROP paired-like homeobox 1 (PROP1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343595 Rabbit Polyclonal Anti-PROP1 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PROP1 or NM_006261"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218746 protein sequence
Red=Cloning site Green=Tags(s)

MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHSRR
RHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSP
AAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPP
PPPMLPLSLEPSKSWN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006252
Locus ID 5626
UniProt ID O75360
Cytogenetics 5q35.3
RefSeq Size 1464
RefSeq ORF 678
Synonyms CPHD2; PROP-1
Summary This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone expression. Mutations in this gene have been associated with combined pituitary hormone deficiency-2 as well as deficiencies in luteinizing hormone, follicle-stimulating hormone, growth hormone, prolactin, and thyroid-stimulating hormone. provided by RefSeq, Sep 2011
Protein Categories Endocrine and metabolic diseases, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PROP1" proteins (3)
SKU Description Size Price
PH318746 PROP1 MS Standard C13 and N15-labeled recombinant protein (NP_006252) 10 ug
$3,360.00
LC416763 Lyophilized PROP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416763 Transient overexpression lysate of PROP paired-like homeobox 1 (PROP1) (as WB positive control) 100 ug
$436.00

file-alt Citations

DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD
Klingler, Ashley, Shi et al
FASEB J. (2020) 34 (3), 4573-4590 DOI: 10.1096/fj.201902696
Cited by 29
AI Summary: OriGene’s PROP1-cMyc-DDK (FLAG) recombinant protein was used in binding assays to assess the specificity of DNA aptamers against the DUX4 protein.
Snippet: The labeled aptamers were incubated with 1 nM of either StrepII‐SUMO‐DUX4‐ His6, 1 nM of PAX7‐His6 (Creative BioMart, Shirley US‐NA), or 15 nM of PROP1‐cMyc‐DDK( FLAG) (OriGene Technologies, Inc, Rockville, US‐MD) recombinant proteins and various
Involvement of PIT-1-Reactive Cytotoxic TLymphocytes in Anti-PIT-1 Antibody Syndrome
Bando, Iguchi, Fukuoka
J Clin Endocrinol Metab (2014) 99, 1744–1749
Snippet: at 14:43 For personal use only. No other uses without permission. . All rights reserved. 24/09/2014 Page 4. Copia autorizada por CDR protein (Origene, Rockville, MD) were used as the antigen, and Ab-mCD3-2 was used as a positive control in this study. ... Cite SaveSaving
Involvement of PIT-1-reactive cytotoxic T lymphocytes in anti-PIT-1 antibody syndrome
Bando, Iguchi, Fukuoka et al
J. Clin. Endocrinol. Metab. (2014)
Cited by 31
AI Summary: OriGene’s recombinant PROP-1 protein was used in ELISpot assays to assess cytotoxic T lymphocyte reactivity, helping to elucidate immune mechanisms in anti-PIT-1 antibody syndrome.
Snippet: All data are expressed as means of quadruplicate determinations. Recombinant human PIT-1 protein (Santa Cruz Biotechnology, Santa Cruz, CA) and PROP-1 protein (Origene, Rockville, MD) were used as the an- E2 CTLs in anti-PIT-1 antibody syndrome ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products