OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLT1 (NM_006519) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318331M
Recombinant protein of human dynein, light chain, Tctex-type 1 (DYNLT1), 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DYNLT1 or NM_006519"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218331 representing NM_006519
Red=Cloning site Green=Tags(s)

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM
QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006510
Locus ID 6993
UniProt ID P63172
Cytogenetics 6q25.3
RefSeq Size 713
RefSeq ORF 339
Synonyms CW-1; TCTEL1; tctex-1; TCTEX1
Summary This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Apr 2014
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Dynein Light Chain 1 (DYNLT1) Interacts with Normal and Oncogenic Nucleoporins
Sarma, Yaseen
PLoS ONE (2013) 8 (6), e67032 DOI: 10.1371/journal.pone.0067032
Cited by 9
AI Summary: OriGene’s DYNLT1 shRNA vectors were used in this study to knock down DYNLT1 expression in K562 cells, enabling the authors to investigate DYNLT1’s role in NUP98-HOXA9-mediated gene activation and cell proliferation.
Snippet: To further test the anti-DYNLT1 antibody, K562 cells were nucleofected with empty pRFP-C-RS vector, vector containing nonspecific shRNA, or vectors containing two different shRNAs against DYNLT1 (Origene) (see Table 1 for sequences).
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products