TICAM2 (NM_021649) Human Recombinant Protein

SKU
TP317645
Recombinant protein of human toll-like receptor adaptor molecule 2 (TICAM2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217645 representing NM_021649
Red=Cloning site Green=Tags(s)

MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE
EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT
ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF
QESVYKTQQTIWKETRNMVQRQFIA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_067681
Locus ID 353376
UniProt ID Q86XR7
Cytogenetics 5q22.3
RefSeq Size 3453
RefSeq ORF 705
Synonyms MyD88-4; TICAM-2; TIRAP3; TIRP; TRAM
Summary TIRP is a Toll/interleukin-1 receptor (IL1R; MIM 147810) (TIR) domain-containing adaptor protein involved in Toll receptor signaling (see TLR4; MIM 603030).[supplied by OMIM, Apr 2004]
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:TICAM2 (NM_021649) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317645 TICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_067681) 10 ug
$3,255.00
LC402870 TICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402870 Transient overexpression lysate of toll-like receptor adaptor molecule 2 (TICAM2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.