OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TICAM2 (NM_021649) Human Mass Spec Standard

Be the first to review this product
SKU
PH317645
TICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_067681)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306163 Rabbit Polyclonal TIRP Antibody
100 ug
$640.00
LY402870 Transient overexpression lysate of toll-like receptor adaptor molecule 2 (TICAM2) (as WB positive control) 100 ug
$436.00

Other products for "TICAM2 or NM_021649"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217645
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC217645 representing NM_021649
Red=Cloning site Green=Tags(s)

MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE
EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT
ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF
QESVYKTQQTIWKETRNMVQRQFIA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067681
RefSeq Size 3453
RefSeq ORF 705
Synonyms MyD88-4; TICAM-2; TIRAP3; TIRP; TRAM
Locus ID 353376
UniProt ID Q86XR7
Cytogenetics 5q22.3
Summary TIRP is a Toll/interleukin-1 receptor (IL1R; MIM 147810) (TIR) domain-containing adaptor protein involved in Toll receptor signaling (see TLR4; MIM 603030).supplied by OMIM, Apr 2004
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TICAM2" proteins (3)
SKU Description Size Price
LC402870 Lyophilized TICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402870 Transient overexpression lysate of toll-like receptor adaptor molecule 2 (TICAM2) (as WB positive control) 100 ug
$436.00
TP317645 Recombinant protein of human toll-like receptor adaptor molecule 2 (TICAM2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products