TICAM2 (NM_021649) Human Mass Spec Standard

SKU
PH317645
TICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_067681)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217645]
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC217645 representing NM_021649
Red=Cloning site Green=Tags(s)

MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE
EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT
ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF
QESVYKTQQTIWKETRNMVQRQFIA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067681
RefSeq Size 3453
RefSeq ORF 705
Synonyms MyD88-4; TICAM-2; TIRAP3; TIRP; TRAM
Locus ID 353376
UniProt ID Q86XR7
Cytogenetics 5q22.3
Summary TIRP is a Toll/interleukin-1 receptor (IL1R; MIM 147810) (TIR) domain-containing adaptor protein involved in Toll receptor signaling (see TLR4; MIM 603030).[supplied by OMIM, Apr 2004]
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:TICAM2 (NM_021649) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402870 TICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402870 Transient overexpression lysate of toll-like receptor adaptor molecule 2 (TICAM2) 100 ug
$436.00
TP317645 Recombinant protein of human toll-like receptor adaptor molecule 2 (TICAM2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.