OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BMAL1 (ARNTL) (NM_001030272) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317474
Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA501174 Anti-ARNTL (BMAL1) mouse monoclonal antibody, clone OTI1C11 (formerly 1C11) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BMAL1 or NM_001030272"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217474 protein sequence
Red=Cloning site Green=Tags(s)

MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI
KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT
FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS
SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCT
IHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFV
FVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWF
SFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAG
AGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQEN
PGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 68.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001025443
Locus ID 406
UniProt ID O00327
Cytogenetics 11p15.3
RefSeq Size 2808
RefSeq ORF 1875
Synonyms bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC
Summary The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2014
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Circadian rhythm - mammal
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BMAL1" proteins (11)
SKU Description Size Price
PH304464 ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025444) 10 ug
$3,360.00
PH307870 ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001169) 10 ug
$3,360.00
PH317474 ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025443) 10 ug
$3,360.00
LC400474 Lyophilized ARNTL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422246 Lyophilized ARNTL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422247 Lyophilized ARNTL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400474 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422246 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY422247 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP304464 Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 20 µg 20 ug
$867.00
TP307870 Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products