BMAL1 (ARNTL) (NM_001178) Human Mass Spec Standard

SKU
PH307870
ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001169)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207870]
Predicted MW 68.7 kDa
Protein Sequence
Protein Sequence
>RC207870 protein sequence
Red=Cloning site Green=Tags(s)

MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI
KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT
FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS
SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCT
IHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFV
FVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWF
SFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAG
AGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQEN
PGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001169
RefSeq Size 2863
RefSeq ORF 1875
Synonyms bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC
Locus ID 406
UniProt ID O00327
Cytogenetics 11p15.3
Summary The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Circadian rhythm - mammal
Write Your Own Review
You're reviewing:BMAL1 (ARNTL) (NM_001178) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304464 ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025444) 10 ug
$3,255.00
PH317474 ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025443) 10 ug
$3,255.00
LC400474 ARNTL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422246 ARNTL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422247 ARNTL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400474 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1 100 ug
$436.00
LY422246 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2 100 ug
$665.00
LY422247 Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3 100 ug
$436.00
TP304464 Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 20 µg 20 ug
$867.00
TP307870 Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 20 µg 20 ug
$867.00
TP317474 Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.