OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

p38 (MAPK14) (NM_001315) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317425
Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA813282 MAPK14 mouse monoclonal antibody,clone OTI5A6 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "p38 or NM_001315"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217425 representing NM_001315
Red=Cloning site Green=Tags(s)

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR
ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY
IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG
CIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPL
AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP
PPLDQEEMES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001306
Locus ID 1432
UniProt ID Q16539
Cytogenetics 6p21.31
RefSeq Size 3757
RefSeq ORF 1080
Synonyms CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; p38; p38ALPHA; PRKM14; PRKM15; RK; SAPK2A
Summary The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. provided by RefSeq, Jul 2008
Protein Categories Cytokines, Enzyme: Kinases, Growth Factors, Intracellular Proteins
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "p38" proteins (11)
SKU Description Size Price
PH306605 MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620581) 10 ug
$3,360.00
PH317425 MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_001306) 10 ug
$3,360.00
PH322774 MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620583) 10 ug
$3,360.00
LC400523 Lyophilized MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408439 Lyophilized MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408440 Lyophilized MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400523 Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY408439 Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY408440 Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP306605 Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 2, 20 µg 20 ug
$737.00
TP322774 Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 4, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products