p38 (MAPK14) (NM_139012) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206605] |
Predicted MW | 41.3 kDa |
Protein Sequence |
Protein Sequence
>RC206605 protein sequence
Red=Cloning site Green=Tags(s) MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPL AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP PPLDQEEMES myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_620581 |
RefSeq Size | 4353 |
RefSeq ORF | 1080 |
Synonyms | CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; p38; p38ALPHA; PRKM14; PRKM15; RK; SAPK2A |
Locus ID | 1432 |
UniProt ID | Q16539 |
Cytogenetics | 6p21.31 |
Summary | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317425 | MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_001306) | 10 ug |
$3,255.00
|
|
PH322774 | MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620583) | 10 ug |
$3,255.00
|
|
LC400523 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408439 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408440 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400523 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 1 | 100 ug |
$436.00
|
|
LY408439 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 2 | 100 ug |
$436.00
|
|
LY408440 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 3 | 100 ug |
$436.00
|
|
TP306605 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP317425 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP322774 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.