p38 (MAPK14) (NM_139012) Human Mass Spec Standard

SKU
PH306605
MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620581)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206605]
Predicted MW 41.3 kDa
Protein Sequence
Protein Sequence
>RC206605 protein sequence
Red=Cloning site Green=Tags(s)

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR
ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY
IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG
CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPL
AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP
PPLDQEEMES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620581
RefSeq Size 4353
RefSeq ORF 1080
Synonyms CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; p38; p38ALPHA; PRKM14; PRKM15; RK; SAPK2A
Locus ID 1432
UniProt ID Q16539
Cytogenetics 6p21.31
Summary The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway
Write Your Own Review
You're reviewing:p38 (MAPK14) (NM_139012) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317425 MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_001306) 10 ug
$3,255.00
PH322774 MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620583) 10 ug
$3,255.00
LC400523 MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408439 MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408440 MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400523 Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 1 100 ug
$436.00
LY408439 Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 2 100 ug
$436.00
LY408440 Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 3 100 ug
$436.00
TP306605 Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 2, 20 µg 20 ug
$737.00
TP317425 Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 1, 20 µg 20 ug
$737.00
TP322774 Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.