SPANXN4 (NM_001009613) Human Recombinant Protein

CAT#: TP316287

Recombinant protein of human SPANX family, member N4 (SPANXN4), 20 µg

Product Images

Coomassie blue staining of purified SPANXN4 protein (Cat# TP316287). The protein was produced from HEK293T cells transfected with SPANXN4 cDNA clone (Cat# RC216287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENN
  QPTESSTDPIKEKGDLDISAGSPQDGGQN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001009613
• Locus ID: 441525
• UniProt ID: Q5MJ08
• Cytogenetics: Xq27.3
• Refseq Size: 431
• Refseq ORF: 297
• Synonyms: CT11.9
• Summary: This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members. [provided by RefSeq, Sep 2009]