OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SH3GL2 (NM_003026) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315806
Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA365772 SH3GL2 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SH3GL2 or NM_003026"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215806 representing NM_003026
Red=Cloning site Green=Tags(s)

MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSM
INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI
DPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIE
QVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHT
GTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL
PH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003017
Locus ID 6456
UniProt ID Q99962
Cytogenetics 9p22.2
RefSeq Size 2540
RefSeq ORF 1056
Synonyms CNSA2; EEN-B1; SH3D2A; SH3P4
Summary Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Required for BDNF-dependent dendrite outgrowth. Cooperates with SH3GL2 to mediate BDNF-NTRK2 early endocytic trafficking and signaling from early endosomes.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Intracellular Proteins
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SH3GL2" proteins (4)
SKU Description Size Price
PH315806 SH3GL2 MS Standard C13 and N15-labeled recombinant protein (NP_003017) 10 ug
$3,360.00
LC418947 Lyophilized SH3GL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418947 Transient overexpression lysate of SH3-domain GRB2-like 2 (SH3GL2) (as WB positive control) 100 ug
$436.00
TP710152 Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products