SH3GL2 (NM_003026) Human Mass Spec Standard

SKU
PH315806
SH3GL2 MS Standard C13 and N15-labeled recombinant protein (NP_003017)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215806]
Predicted MW 39.8 kDa
Protein Sequence
Protein Sequence
>RC215806 representing NM_003026
Red=Cloning site Green=Tags(s)

MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSM
INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI
DPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIE
QVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHT
GTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL
PH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003017
RefSeq Size 2540
RefSeq ORF 1056
Synonyms CNSA2; EEN-B1; SH3D2A; SH3P4
Locus ID 6456
UniProt ID Q99962
Cytogenetics 9p22.2
Summary Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Required for BDNF-dependent dendrite outgrowth. Cooperates with SH3GL2 to mediate BDNF-NTRK2 early endocytic trafficking and signaling from early endosomes.[UniProtKB/Swiss-Prot Function]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:SH3GL2 (NM_003026) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418947 SH3GL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418947 Transient overexpression lysate of SH3-domain GRB2-like 2 (SH3GL2) 100 ug
$436.00
TP315806 Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), 20 µg 20 ug
$737.00
TP710152 Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.