SH3GL2 (NM_003026) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215806] |
Predicted MW | 39.8 kDa |
Protein Sequence |
Protein Sequence
>RC215806 representing NM_003026
Red=Cloning site Green=Tags(s) MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSM INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI DPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIE QVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHT GTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL PH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003017 |
RefSeq Size | 2540 |
RefSeq ORF | 1056 |
Synonyms | CNSA2; EEN-B1; SH3D2A; SH3P4 |
Locus ID | 6456 |
UniProt ID | Q99962 |
Cytogenetics | 9p22.2 |
Summary | Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Required for BDNF-dependent dendrite outgrowth. Cooperates with SH3GL2 to mediate BDNF-NTRK2 early endocytic trafficking and signaling from early endosomes.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Endocytosis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC418947 | SH3GL2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY418947 | Transient overexpression lysate of SH3-domain GRB2-like 2 (SH3GL2) | 100 ug |
$436.00
|
|
TP315806 | Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), 20 µg | 20 ug |
$737.00
|
|
TP710152 | Recombinant protein of human SH3-domain GRB2-like 2 (SH3GL2), full length, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.